DPCstruct | MC8511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 226 ± 29 aa |
| Standard deviation of domain lengths | 28.86 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9E3R4 | 362-559 | WNGEGSMHPPHPVVTTAASTNSSQPTASCSIYCFLCGLHSDLTLARVLYGRPQGRNAPFFPALLRHSSPPNAEQLREDGSALVCTFC… |
| A0A8B6FTJ7 | 2-242 | MSFIPKSKSPFRANKSPAIETIAKTVPHPLQQATTIPKKICFLCGEKCRLSKAHVLCSYPTRHEAKTLNNQTVPFFPFLANREPAPK… |
| A0A226ELC5 | 1-241 | None |
| A0A226EVL3 | 4-259 | None |
| S9YG61 | 258-451 | None |
| A0A1A9ZV70 | 83-334 | None |
| A0A6G0U8A5 | 53-291 | None |
| A0A455B6T6 | 484-655 | None |
| A0A132AGS1 | 674-892 | None |
| A0A443SWP3 | 34-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.