DPCstruct | MC8510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 383 ± 56 aa |
| Standard deviation of domain lengths | 55.61 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433SLU9 | 1-323 | MLVKVLRFKAQGATYMNWMSKDRLVDSCYEDLKNATPNFFSIMGDDVIRRRFFIQNNYGGCANDAGWTVAVDSPSPPCTWEKNETFP… |
| A0A8B6FSK2 | 152-503 | RSQSECNPLPTSFATVGSQRHLRNSVVDDWNNTNIRMVKVEFFKNNQVVAWMTFNGRNTDKMNWFSKSNLAQSGFNDLGSRSTFNYF… |
| A0A2T7PRG6 | 80-450 | None |
| A0A1I8H7U4 | 231-597 | None |
| A0A8B6BVH4 | 2-367 | None |
| A0A2T7Q1H3 | 8-370 | None |
| A0A1I8FM87 | 77-449 | None |
| A0A1I8IGX2 | 213-534 | None |
| A0A2T7PRB9 | 201-726 | None |
| A0A1I8GLC5 | 212-618 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.