DPCstruct | MC851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 245 ± 21 aa |
| Standard deviation of domain lengths | 21.24 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7JXR4 | 14-250 | NLNLFDLFSMFSIDGKTKYTEMLLRLMKSTPNIDQHVKEIKTHLTNELNIKKSDLDLIPDIQLILFFKMVDNLFNLSDLKSFQKFCE… |
| A0A2D6WYM4 | 87-318 | EVFEEIVDADPTGNKSFVQWMLGVFARHLKDGDMDQAVRFLSEDLPEANEYLEVFDRVRKKKVFKTGAPNRPNAPSNVTDINQYTDL… |
| A0A3S4CAS0 | 2-220 | None |
| A0A2D6E213 | 15-259 | None |
| A0A6C0JU29 | 13-286 | None |
| A0A7C3WWY8 | 270-510 | None |
| A0A1F2Z0B1 | 9-278 | None |
| A0A1E4G2G1 | 29-310 | None |
| A0A842WLS5 | 10-238 | None |
| A0A2W5FIA6 | 2-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.