DPCstruct | MC8509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 123 ± 7 aa |
| Standard deviation of domain lengths | 7.35 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15813 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4WNF6 | 55-178 | VRLQVNVTEEDVCLSAQACVVRLPPLRLSDLGASPVALVDFNARLTDVISESQLTGRWCHILPRMTKGQVATVTRHLPPSGPFGAYR… |
| A0A2D0RZS7 | 144-268 | VVMELNVNETELCVSVEASTIRLPPVTLRDFDVPAPVMERFLNNQETVLHTKAPNNWCYVLPSMKKGQVVSIGRTLPPECPFQTYAD… |
| A0A3B4AAZ4 | 110-214 | None |
| A0A3Q2PCP4 | 8-135 | None |
| A0A7R9CHD6 | 148-272 | None |
| A0A1S3ISV8 | 1-133 | None |
| A0A3Q3X381 | 79-195 | None |
| A0A7M7LTD5 | 167-299 | None |
| A0A553PTG3 | 174-300 | None |
| A0A674GC79 | 141-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.