DPCstruct | MC8508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 158 ± 28 aa |
| Standard deviation of domain lengths | 28.46 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF02825- CL0760 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7WGS6 | 15-169 | VIVYWVSYLEGPQRILMFTQDERIAYKARLRIDSEKSHTELFLSLKGIGISLASQVNNQLQEVAYAALRDSAPIWEVNVAHKWKPLT… |
| A0A8B6FPK5 | 18-133 | IGVSIINRAQEEVAFISISSMPSMWEIEVKNKWKMLEDVTLVTWLEDKWNHAVEHANLEDRIEVDFSTVGKLRMMKPYMGELRRVCP… |
| A0A820AD53 | 451-634 | None |
| A0A0D8X636 | 46-177 | None |
| A0A4Y2M1S9 | 189-353 | None |
| A0A821A7C4 | 234-414 | None |
| A0A6P7TUP0 | 4-135 | None |
| A0A7J7KK36 | 234-410 | None |
| A0A6J8EUH3 | 337-496 | None |
| A0A3Q1BKM5 | 365-526 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.