DPCstruct | MC8507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 177 ± 14 aa |
| Standard deviation of domain lengths | 14.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1R523 | 163-335 | VEDETESADGKSLVEVKLKSALSRNPKIIAQTIVFSFLQKKAHPERDTFLTPCIGIGSSELVVMFYDCEHDVLLESSSIPLFSDPSS… |
| A0A8B6FNH6 | 21-192 | RLLEHTNGTDGEGSILTLKHNIFTTCEDQFLKTEKTLRQSFAQTLTNAFYQVKQNPKLQNLCIPSFLASDNKVRIIMYNCEQDRLYI… |
| A0A8B6HBX3 | 1-162 | None |
| A0A8B6CQ50 | 122-295 | None |
| A0A210Q582 | 17-194 | None |
| A0A210Q118 | 314-491 | None |
| A0A210PH74 | 217-397 | None |
| K1PWB1 | 474-640 | None |
| K1PWW7 | 41-217 | None |
| A0A6J8D7D1 | 140-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.