DPCstruct | MC8506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 87 ± 12 aa |
| Standard deviation of domain lengths | 12.27 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D2V3B6 | 818-912 | HPRLKQVVYWDKHPQPTHSYCLGALMQKYYGQYDVETAIQIMGMAATGNVQAAVFDFAKNNVYVAYERQDNASGPLFAYQRTFIKFD… |
| A0A8B6FNF0 | 15-92 | QLTKHYGNITVENVIRDVTSITQTGNLHIAIYDLTNSIAYLANAKSTNQSGPLYAYERSFVRLNMTELFNVIPPEENS |
| A0A820L689 | 2-75 | None |
| X6MLM2 | 79-166 | None |
| A0A5C6D7J0 | 97-169 | None |
| A0A816GLI0 | 100-178 | None |
| A0A815UHD9 | 23-100 | None |
| A0A815UZ26 | 11-82 | None |
| A0A818X897 | 709-807 | None |
| A0A7S3NH15 | 41-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.