DPCstruct | MC8505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 62 ± 11 aa |
| Standard deviation of domain lengths | 10.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 50.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05731 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183JB44 | 43-92 | QTTHQMTPMDSSQVRNYAGGFVFKVDEITRVRRFLILGVEGGTYYVKEME |
| A0A822C534 | 1-54 | MSTQNKPQSKPLRNDQVKNNAGGFVWAVNDMQRLQRFLCLGCEGGTYYQGEKEL |
| S9WHP6 | 2-68 | None |
| A0A2J8ACE6 | 26-88 | None |
| A0A5E4ASM4 | 164-238 | None |
| A0A819L6I3 | 2-62 | None |
| A0A4X1TW98 | 178-259 | None |
| A0A0D6L7C2 | 37-88 | None |
| A0A183E0D6 | 42-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.