DPCstruct | MC8504
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 168 ± 30 aa |
| Standard deviation of domain lengths | 30.46 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L2PPQ6 | 2-160 | NYKDPALHFKVDIGFPRPKPSRSQELKERIAILRASRSNPELERLSRTKQLEVSLKEVQEEWLKTAGPFHIRRVAEHYGVYDDLFGD… |
| A0A8B6FLV6 | 23-185 | VRTKMYWPRKIEPEEEKTHAQRITEMKQTDPELDKVINIGFPVTKFDRTERKKMKHQLKESIAEKKLDLERAARTRTLNVPLEEVKK… |
| A0A183W3T9 | 4-128 | None |
| A0A3P7LZ17 | 1-157 | None |
| C1BLY2 | 36-203 | None |
| A0A7D9MBD1 | 10-189 | None |
| A0A2H9TK15 | 30-187 | None |
| A0A6P4E5C2 | 17-219 | None |
| A0A821RZN4 | 4-163 | None |
| A0A183TAM2 | 1-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.