DPCstruct | MC8501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 198 ± 18 aa |
| Standard deviation of domain lengths | 17.83 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15877 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7F8RNB9 | 1-183 | MLYASLDHASFDYDHLPTLFFVAESVLYRLCCDAFQKTYLYSVEIKLIKIGYLVFLRLFIYFLHGHLESFKQHLFRLQPYLYALCFS… |
| A0A369S1N2 | 101-302 | AWCELSMLAQCQGRVREDSLEILITSLDQAPLNEDHLSSLFYLAEVSIYWLKKSAVSKPLLRSAEIKLMKLASSVFLRIFCYYCLKV… |
| A0A7J7KFR0 | 100-317 | None |
| A0A3L7IEP9 | 103-288 | None |
| A0A0D9RRC1 | 118-299 | None |
| A0A819PJ18 | 614-842 | None |
| A0A3Q0EFF2 | 1-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.