DPCstruct | MC8500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 759 ± 70 aa |
| Standard deviation of domain lengths | 69.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2YR80 | 15-750 | IIVLLSSISCSNANKTNSYNSSTVVLVHVLFRHGERTPGKYDLWKSNPYYNESYYKPYGYGQLTNDGKERMYNVGVELRERYADFLG… |
| A0A8B6FJX7 | 1-849 | MEYIIILTVMLFSITKVIPEDNLKKPIFNAMTPYFWVKNINETIPEDRDGSLMYGGHSCQITNVHYLFRHAARYPSLPWIQKMDNIS… |
| A0A2A6D0A6 | 470-1229 | None |
| T1JEQ9 | 101-793 | None |
| A0A0N5AYL6 | 1-833 | None |
| A0A4D9ENH2 | 2-675 | None |
| A0A232EEI8 | 21-702 | None |
| A0A1B0GD38 | 305-1147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.