DPCstruct | MC850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 159 ± 18 aa |
| Standard deviation of domain lengths | 18.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B9AL25 | 4-151 | ENTMKFYGPPNEASPSYLIWYNNGPWKRTIAFRDEVPHDFPEPHSDVLEQFIDYHVPADKVGLVAQLEGSLVIDRTKGEVSVHCDNE… |
| A0A5C7JXL4 | 5-173 | WKFNGAKEQLIFLTSLFGKSDTLAQQAGGSAKWTESLKDKKLFGLPICFSSYEVKDEEVYSLFPVEHFENQYASVIVNVEPATLEYL… |
| A0A424STS0 | 13-158 | None |
| A0A7Y5TSW6 | 3-159 | None |
| A0A4R5A9J1 | 431-594 | None |
| A0A7V9SI00 | 1-135 | None |
| A0A2E6W7R1 | 255-405 | None |
| A0A0F9EH53 | 20-170 | None |
| A0A846KX34 | 1-107 | None |
| A0A4S8HLC3 | 26-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.