DPCstruct | MC85
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 78 ± 4 aa |
| Standard deviation of domain lengths | 4.13 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 28.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G8BFW1 | 1-80 | MNFEFPEERIKELKELQSEAGLDTMKDLINNAITIFEWAVHETRKGNEIAAVNEAGESYRVLITPALQRVAKERVVREKA |
| A0A0G0NL50 | 19-96 | ISKTRIQLEVGPERIKELETLMSQTGLRTKADLLESALALFEWAIHERSSGNVIASLDEASHEFKQVCVPSIERVAPK |
| A0A351SJS6 | 51-127 | None |
| A0A1F8SVP6 | 1-77 | None |
| A0A1F2UTG3 | 1-78 | None |
| A0A1F9VMT7 | 1-82 | None |
| A0A4Q3Y6S4 | 1-87 | None |
| A0A7X2PG06 | 16-89 | None |
| A0A1W6MXD9 | 1-75 | None |
| A0A1G2MCR3 | 20-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.