DPCstruct | MC8498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 138 |
|---|---|
| Mean domain length (aa) | 200 ± 44 aa |
| Standard deviation of domain lengths | 43.93 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 78.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6FH70 | 180-357 | RIGLKFIRYSIGWYNVYHGFITKTGEEQQRIMNGYYSFQQIVDEFQKENIVLSVNEANGIASLNTTTELKISKGLGNMLGFNNKRKF… |
| A0A1Y1M5S2 | 13-213 | ILNAFFRPPLLLNDDDYVMGLTNFETYNSIHNVTPTNNKFKYGNQMITIPPGCYEISDINNYINAQLNRTSGDYVELQANNNTMQSV… |
| V4CPV5 | 22-196 | None |
| A0A4Y2CFI4 | 31-204 | None |
| A0A6V7WGE2 | 304-483 | None |
| A0A6V7XJM9 | 397-567 | None |
| A0A6V7WM31 | 271-450 | None |
| H3A7V0 | 96-284 | None |
| A0A2G5UIE7 | 47-242 | None |
| A0A7D9MCA7 | 258-426 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.