DPCstruct | MC8494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 10.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8QL60 | 1-114 | MTTTKKASQFGALQIAIILLTVATAVIHLALGISLLSLGGLPMFILNGIGYLALLVALFLPQLRQYQKYTRWVLIGFTAITVLAWVA… |
| A0A0P6XQ54 | 8-104 | TRFLRRLVITLLTVATAAIHFSLLFPDPVFILNGLGYLILLGAYLLGPSRLGERFRWVRYGFIAYTGLTVLLWILIGARTPLGYFTK… |
| E8MY77 | 1-109 | None |
| A0A5J4KMJ1 | 11-124 | None |
| A0A3L7Y436 | 1-110 | None |
| A0A535A4E1 | 1-94 | None |
| A0A402A6D2 | 1-118 | None |
| A0A6J4QKQ1 | 28-150 | None |
| A0A2E1AI74 | 78-182 | None |
| A0A2E0Z9E8 | 22-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.