DPCstruct | MC8493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 99 ± 7 aa |
| Standard deviation of domain lengths | 7.39 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X3ZDF0 | 69-162 | PWYFPNLGEYARLVELAGLRVAYASNFPRPTPLEGESGLRDWMAMFAETLIADVPPSMREELWDAVEDAVHPALYDEGGWHADYWRL… |
| A0A1F8QEX2 | 1-108 | MVVPCSWFFPRPDEYRRHLEAGGFAVKTIDLFPHPNPLPGDINDWLEIFAQPYTAALPPAEQGAFISDVVEMLRPALCDASGRWTAD… |
| A0A1C0YND3 | 1-109 | None |
| A0A1H6A3L8 | 156-250 | None |
| A0A4Y2UFU9 | 28-117 | None |
| A0A5N6F4I5 | 24-134 | None |
| A0A356IF47 | 156-252 | None |
| L8WWI2 | 750-843 | None |
| A0A7W3MXW1 | 156-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.