DPCstruct | MC8487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Standard deviation of domain lengths | 4.81 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 45.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08929 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A373VZV2 | 2-75 | INSEDKVDKLKEYVKRFWYREHRQAFWHNTHNLSTNCYYGYWSFEAGAIAKILKLDDYELKDMKYYPYDLVHYK |
| A0A1G6Z5U7 | 38-100 | LRKYLEKYWYNGHSDSGWHDTHKHPDPIYSGYWSFESGAVSKILGVDDSSLKDVPYYPYDMVH |
| A0A375J750 | 140-214 | None |
| M7NJD6 | 335-401 | None |
| A0A0J1HVM4 | 2-61 | None |
| A0A4Q9QG48 | 4-69 | None |
| A0A250EY43 | 20-86 | None |
| A0A3R6TDS0 | 78-150 | None |
| I9T3K5 | 2-65 | None |
| A0A7W7UKJ0 | 2-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.