DPCstruct | MC8486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 146 ± 14 aa |
| Standard deviation of domain lengths | 14.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 64.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08766 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A0L2T2 | 106-261 | KSESAKSSAKKSSASRAKVDDNDASPKVFSRKKNSEKESKASTPTKSANKEKPGKKVVKGKDNKTKEEKTRPSDDELREAICEILKV… |
| A0A7K1IN17 | 1-137 | SKAEESDPGHKTFSRKKKDAAVEEKPVTTKKAAAPKEKTGKKTVKEKPKSEKQKLSDDELRDAICEILKEVDFNTATFTDILKKLAK… |
| A0A4P1R6M3 | 624-752 | None |
| A0A565CRD5 | 1-156 | None |
| A0A2P5XLM8 | 46-198 | None |
| A0A540LI95 | 22-179 | None |
| A0A453GDA9 | 80-219 | None |
| A0A835VKG6 | 139-293 | None |
| A0A1S4DKM4 | 188-338 | None |
| A0A2Z7B4C4 | 49-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.