DPCstruct | MC8483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 133 ± 12 aa |
| Standard deviation of domain lengths | 11.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 34.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839R387 | 1-115 | MATFVDPVADGAEAYEGLRGLAHATRAFEDPAHTYRVLGEVSGSVRLLRQVLDQLSRVHADHRDIAFTDDRAPAEAVALAAADELHQ… |
| A0A7K1IBF3 | 1-148 | MSSEPVPSAADAAREALRALAHATQTIPELGDSYSVLGSLHAGLSSLRQTLDQLADLHERHAPRAVAADPDQLGREVAADIAAAELR… |
| A0A3N4ZSV7 | 1-151 | None |
| A0A2P7AAQ8 | 1-134 | None |
| D4YPS9 | 1-127 | None |
| A0A6D1V4N2 | 3-118 | None |
| A0A1M6GAQ2 | 1-121 | None |
| A0A6N7EFG5 | 74-218 | None |
| A0A1W2BN28 | 1-136 | None |
| E9UVS3 | 46-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.