DPCstruct | MC848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 526 ± 94 aa |
| Standard deviation of domain lengths | 94.38 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 17.79 |
| Pfam Score | 71.67 |
| Assigned Pfam label(s) | CL0125- CL0672 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522D7B8 | 637-1228 | LDETMYRVLADGSYERSVRKIYKLQHESILDDFRQQYIVFDPAVDRITDVRCTVINDGAGTDAAEGYTHSLSEPESRLYYDVSARTV… |
| A0A662AJZ8 | 425-989 | ILDETQKIIYERGGSEEKTYLLVKVFNPTGIDVWKEYSVGYADIIKAEVLKKDGNKLKAETRGGHIVFTNLEEGDAILLIYKRELAN… |
| A0A0N1LC83 | 37-602 | None |
| A0A1Q7HX19 | 1-411 | None |
| A0A538Q2T1 | 71-539 | None |
| A0A5C8J9L7 | 2-345 | None |
| A0A2N5YR18 | 20-519 | None |
| A0A1G3LFU9 | 169-773 | None |
| A0A3C1L1N8 | 10-527 | None |
| C6XAB6 | 71-668 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.