DPCstruct | MC8479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 151 ± 28 aa |
| Standard deviation of domain lengths | 28.30 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A075AMS4 | 1-163 | MDRQLQSIFERFCSFGSGSMTNLSAPMPQMDGAKFAKFTRDTKIVDNKRINSTQVDIIFNKIKHKNERKIDYAQFRKGLQMLAQLKF… |
| A0A7R9Z6E0 | 216-332 | VELKSVFERFNLWEHGYSKSNMDKIRFHKIMRDAALMTEQVGGLTVEFIDSVFFKVLPPSQDSFNFLKFVDTLRYVATKLRTSLNVV… |
| A0A834NC97 | 2-110 | None |
| A0A821H4A5 | 1-116 | None |
| A0A6U1ARN3 | 108-232 | None |
| A0A061RBF8 | 51-158 | None |
| A0A1D2MWG5 | 805-971 | None |
| A0A7S4QT68 | 113-208 | None |
| T1ETV3 | 9-168 | None |
| D6WBV3 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.