DPCstruct | MC8478
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 256 ± 53 aa |
| Standard deviation of domain lengths | 53.49 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 71.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2FST5 | 2-209 | IAGLALERTAVLLLNLASVAVTRNSNGGPYMLSWWLWKAFHFNPHRWITVSLPVLVTVLALTTTLIQLTSFVLLSDIDLVVVKASSK… |
| N1S1Q4 | 1-281 | MSKTMEEIPKTSLVAQTSCAILVFLWKDAQIARDRGEPAKFWKTIVFRNMATKVITICFTAMRVSTGLHISLVATAVAALMLEATGT… |
| A0A3L6MVT8 | 3-191 | None |
| X0MLU4 | 2-227 | None |
| A0A0D2HHH9 | 1-198 | None |
| A0A1B7YM88 | 27-355 | None |
| A0A1B8B9P8 | 25-366 | None |
| A0A484G664 | 2-251 | None |
| A0A5J5EHR6 | 4-306 | None |
| A0A1V6QQF3 | 2-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.