DPCstruct | MC8477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 368 ± 45 aa |
| Standard deviation of domain lengths | 45.20 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A327Z4E0 | 85-395 | LLLVAGCSIGWAFWCRAQLRRFRPGRAPTSPADTPRLREIERLQYGNTVIHGFHPYVGAGEVIGTWGFAQRLLRPADPAGPPRAESE… |
| A0A7K2GBN5 | 59-452 | VVRHDLDVDRVLRTTLTRETYDPRAHPAAPPQEWIAQRLAAIAEARDGNVTVYSGFSPWAGYPQALVEWPLTVPLLPASDAAGSRRG… |
| A0A419HEH5 | 1-326 | None |
| A0A4S2UX35 | 2-365 | None |
| A0A845X1R6 | 79-496 | None |
| A0A0Q8PY57 | 378-750 | None |
| A0A6I4NEI6 | 211-548 | None |
| A0A1K2ER99 | 154-491 | None |
| A0A2S6GZN7 | 246-630 | None |
| A0A429I3Z4 | 141-618 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.