DPCstruct | MC8476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 124 ± 16 aa |
| Standard deviation of domain lengths | 15.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A344L565 | 173-261 | AQPRVDCPDVASQLPEEVPEPAQDEVDAELGALDSQLDAAEQKVQAGEDPAAVLEPLKGERAAAIDRMSDAIGAGLPDLAQCGIKDQ… |
| A0A7K2GAP9 | 3-110 | GAGDTGAGNTGAGTISCPDVASRLPAVPATAQAEVDRNLTLLQTQIDEANKRLVDTVGQGGPNFVDNAILGPLKDKRASTIDRIALS… |
| A0A3A9ZSC6 | 152-271 | None |
| A0A7W8BS65 | 2-134 | None |
| A0A2W4KV52 | 17-133 | None |
| A0A0F0GYY1 | 260-385 | None |
| A0A3E0HIB4 | 124-246 | None |
| A0A543IQ14 | 26-166 | None |
| A0A7X0GWX2 | 13-151 | None |
| A0A291Q609 | 2-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.