DPCstruct | MC8474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 5.81 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 52.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R1RBS6 | 182-275 | NSNDPRMAAIRDYVVAYAQFELDNGVDVVPTDPALSDEALSAALMAAANKDIGTVEQPGDAVVADPAVMAWAKDVLGVGPAVGKIDQ… |
| K0PXR7 | 13-92 | HTNDPRMAAVSAYVKAYAEFEAENGPDAIPTEPAFSDEALRDALSGFTKDGVVTDAALARAKDILGVGPAVGKIDQIRDT |
| A0A4Q2TEV7 | 25-116 | None |
| A0A5R9NV79 | 1-79 | None |
| A0A4S8Q223 | 51-134 | None |
| A0A0Q6GIK7 | 104-187 | None |
| A0A846LE03 | 1-80 | None |
| A0A504U7A0 | 1-87 | None |
| W6RLI8 | 1-92 | None |
| A0A7X0MH86 | 119-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.