DPCstruct | MC8473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 112 ± 9 aa |
| Standard deviation of domain lengths | 9.19 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4Q5X8 | 340-461 | RAEWPETWGMCVASQVDSPLTFDPFSNPEPIFSDWWSAQPFLANGTNAICGGTVRLAGVDFGITLFNQGRELEAFDAPENPNRGSIQ… |
| K0PWA1 | 1-111 | MLDSRTEWPAGAGLYCVMKTDDLTVNHSRFQFQPLTNDKDEIEALALSIFGLTFILLLETADAAYPFIREAKYRPARIVIAYPSSTN… |
| A0A7X8S606 | 1-115 | None |
| A0A132TAS7 | 255-380 | None |
| A0A7W6JFL1 | 212-312 | None |
| A0A7V7T284 | 78-178 | None |
| A0A4V0I6Y0 | 160-261 | None |
| A0A1A2G640 | 123-222 | None |
| A0A426QT40 | 2-126 | None |
| A0A1F2U0H0 | 114-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.