DPCstruct | MC8472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 516 ± 108 aa |
| Standard deviation of domain lengths | 107.62 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 73.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 29.13 |
| Pfam Score | 85.27 |
| Assigned Pfam label(s) | CL0195- PF18562- PF21807 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A024XF42 | 249-640 | QLREDWWNANRETVWEALTCEVGSGTYFHATCSDLNESLSQATKQCRCGDGDVNIVPTYFDYVPQYLRWFEEWAEDFCRKRKKKIEN… |
| A0A024VXC7 | 58-502 | ICALTYTEKKDTGESAKIKQDSGLKNALLDNDGKKPKKNGKYSDYEKVKLEDTSGPKINQSSSTSENKPTTLTNFISRPPYFRYLEE… |
| A0A024VT32 | 25-538 | None |
| A0A0L7KM70 | 18-466 | None |
| A0A024VUA3 | 502-1140 | None |
| A0A0L7KKM4 | 43-436 | None |
| A0A0L7KL70 | 1-447 | None |
| A0A0L7KL97 | 30-394 | None |
| A0A0L7KLS5 | 142-661 | None |
| A0A024WYH1 | 176-837 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.