DPCstruct | MC8470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 135 ± 24 aa |
| Standard deviation of domain lengths | 23.88 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.46 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | PF20597- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815HW40 | 18-132 | KSSLDAMQNGPHEEYLYIVMISCDETKPDYLATIDINPHSSRYQQVVSRVYAQQPQDEFHHFGWNTCSSCHGDQEKKRRFLIIGTLK… |
| A0A4S8UCX3 | 5-176 | ASETYLYSADMWANKVWCHKKDPETGHMTTVGSVDAPAPGDHPRWVEIAPSGKYLYALMEGGNRLGVYSIDPETHMPVYTNKIYPLV… |
| A0A6V7QY21 | 353-499 | None |
| Q2GSJ6 | 1-163 | None |
| G0PN61 | 257-380 | None |
| A0A820A2E0 | 2-143 | None |
| A0A816VIW6 | 48-154 | None |
| A0A674H329 | 4-125 | None |
| A0A3P6QSC5 | 3-131 | None |
| A0A815CDQ8 | 137-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.