DPCstruct | MC847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Standard deviation of domain lengths | 4.03 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522CRB7 | 3-72 | ADKNERCSVCGKTDAKTECDHCGAPLCRDCCKLEIWGSGAEDLSARYFCPACKEDPAVNPWGAHYNVPDT |
| A0A1V4XIH5 | 2-61 | DRCEACGKRAAWTPCMGCRKALCEGCAHFELLAEGCGTVVPAYFCETCVADPLCNPNAIF |
| A0A1V6GKH9 | 1-67 | None |
| A0A7C6NC30 | 2-59 | None |
| A0A1V4S5T0 | 17-84 | None |
| A0A2N2K7G4 | 6-65 | None |
| A0A846ZYU3 | 4-71 | None |
| A0A1V5HER1 | 2-67 | None |
| A0A1V4XFA7 | 2-63 | None |
| A0A1V5E4F7 | 5-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.