DPCstruct | MC8466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 119 ± 8 aa |
| Standard deviation of domain lengths | 8.08 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14240 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078A4L2 | 405-520 | CVNSSSCSADVRNHSVSHVPSQKRTQTPIGIAKDGRLIYGPYRKDGKLWQPCDVDICNGVIFQDLNYGYVATMFHPYTVGCYGPGNA… |
| A0A814A2K6 | 143-257 | PPTGTIGSCKSTPACNASIANYSISKFSPYRTLTVIGIAKDGHVIYGPYDSTGAEVTSGFDICNGMFYDSIGNYAYFATRTFPYITG… |
| A0A815BPU7 | 1-130 | None |
| A0A813X3B7 | 121-258 | None |
| A0A821KD21 | 203-317 | None |
| A0A819GLJ2 | 62-176 | None |
| A0A819XAW9 | 229-352 | None |
| A0A078A6Z4 | 783-903 | None |
| A0A078AV57 | 258-381 | None |
| J9I4S8 | 524-647 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.