DPCstruct | MC8465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 197 ± 32 aa |
| Standard deviation of domain lengths | 32.17 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.50 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | PF14825- CL0255 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3HFT4 | 3-151 | PRRKPGPECQDFRKLNRLAAQSGVTNASQLADWRTTNDVKLVAKGPAGSMPKVIPSDVIPSFAYGKKSRPSTPIASVMGNHYGLEQE… |
| A0A815BP01 | 21-189 | ESELQLLSEVGKCHRRGHKLPPSDFVYGLRNIQHDRGVAEALCQSFTEQSRNSPEFILVRDYLALNRAALEAGATTARNQSRFRMIH… |
| A0A7J6SVA9 | 8-189 | None |
| A0A0V0QCI1 | 2-120 | None |
| A0A1S8VZ03 | 22-264 | None |
| A0A6J0TSF0 | 22-248 | None |
| S9X7A9 | 199-398 | None |
| M7BRH3 | 127-316 | None |
| V4A441 | 4-203 | None |
| A0A210Q1N0 | 1-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.