DPCstruct | MC8464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 181 ± 21 aa |
| Standard deviation of domain lengths | 21.29 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819SFI5 | 147-315 | IQLAEQLQMTQKLLESAVPTINNHSEAINALESRVSFLQMQFQHSFLYQAITQIFRNDLTLAFLAPQDLHTVVYSVIRQGNLTFNPH… |
| A0A815B2L3 | 30-197 | STELPHFQAGELELAPTLNHTQSALNRTINLINHHRITVEHLVESHFLHTAITDILANRLNLNFIHHRDLNKVAKHIATATNVNFTA… |
| A0A819T181 | 1-152 | None |
| A0A816UNG5 | 56-226 | None |
| A0A820UWH7 | 2-178 | None |
| A0A816NU28 | 57-228 | None |
| A0A820B7E4 | 17-238 | None |
| A0A817LGC9 | 1-162 | None |
| A0A815XHQ8 | 4-163 | None |
| A0A814T9R1 | 17-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.