DPCstruct | MC8460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 120 ± 23 aa |
| Standard deviation of domain lengths | 22.71 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20965 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A669R445 | 1-122 | LELLCEKSIGTANRPMGAGEALRRVLECLASGIVMPDGSGIYDPCEKEATDAIGHLDRQQREDITQSAQHALRLAAFGHLHKVLGMD… |
| H2Z308 | 101-198 | ALELLVEKSLRTSPVPMSLGGSLQRVMEVIGSGILLAGSGGVQDPCEREEVDVMDHLSEQDREDLTVSAQNFLRMLVFRQAHRVLGM… |
| A0A7N4NKQ5 | 165-279 | None |
| A0A817REQ6 | 182-276 | None |
| A0A7R9NW40 | 297-423 | None |
| A0A6I9K717 | 240-356 | None |
| W5MIW5 | 54-218 | None |
| A0A7E4WCC2 | 1054-1177 | None |
| A0A819MCK8 | 322-428 | None |
| A0A287D9Z0 | 151-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.