DPCstruct | MC846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 259 ± 26 aa |
| Standard deviation of domain lengths | 25.96 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C0AAP1 | 24-279 | TLEEKKYIVIHGKLTYGGRNKTYGLFRATINRDNGELINLDVAFSNKDEVVYVEPSSKAFDRIFSKISDKEKLAGRRLRIYLLNNIT… |
| A0A522CMX7 | 12-279 | EDGFFIIKARFKAQALNLYGLVLVVFNRKNQIDNFNVVVSSSAALFDFEPHIGWEKYEEAIMGTKWEGNFNTSMTTSIMDQVKTLTY… |
| A0A7C4J4V2 | 180-461 | None |
| A0A7V4KHB3 | 8-253 | None |
| A0A1V5K048 | 67-367 | None |
| H0UPC9 | 2-256 | None |
| A0A0T5XAY3 | 51-344 | None |
| A0A1F9V1A1 | 35-264 | None |
| A0A7Y3L1M8 | 7-221 | None |
| A0A2N2F0D8 | 40-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.