DPCstruct | MC8454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 102 ± 14 aa |
| Standard deviation of domain lengths | 13.84 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 42.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0XQN9 | 3-73 | YQYCGPGTKLNKRLARGDKGINPLDTACREHNIAYERSNSIVDRNEANHILEQRAWERFKSKDSGLKEKSV |
| X1XLM5 | 3-99 | LMNDLLNSKFMPEIHWPGYNYLGPFTDLEKNKKPVNKLDMAAMEHDYFYKKHKDIKTRHIGDKILEDKAWGRVLAPDASIGEKAAAY… |
| A0A6G0YAL8 | 9-96 | None |
| A0A6G0Y8F9 | 48-134 | None |
| A0A6G0Y0W6 | 13-112 | None |
| V4B9E9 | 18-128 | None |
| V4B8J6 | 4-124 | None |
| V4B5V8 | 19-126 | None |
| V4B0C5 | 15-126 | None |
| V4AMI4 | 7-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.