DPCstruct | MC8452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 104 ± 11 aa |
| Standard deviation of domain lengths | 10.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0595 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L7LPW8 | 228-329 | TLIIPGNKYIAMTKDKLQHCTFDDMKECKVVSPGNFICDVTNVYTTDAMPSCESELLSKVIREVPKQCDVKFVYGKLDIWKPLANNK… |
| X1XE53 | 1-100 | MYIKPKHDFLAVTKSKELYSTYDDFNPSLCKSVHEFLVCPETNPLHSRRPVCEILLMQEPREVPENCEIRHIEMATTVFHKLRQKYI… |
| A0A6G0YM90 | 280-372 | None |
| A0A6G0Y215 | 421-513 | None |
| A0A2J7PKF4 | 1-119 | None |
| X1WK82 | 275-398 | None |
| A0A6G0T3A2 | 452-552 | None |
| A0A6G0SXT6 | 788-882 | None |
| A0A5E4NAK1 | 183-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.