DPCstruct | MC8451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 167 ± 23 aa |
| Standard deviation of domain lengths | 23.42 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S2NGY7 | 21-135 | LETDILKLTSMEYAGENVLVIESKNQEGCRVLLNRADVMELQKLEHCIFDSITQKCAIIQPKILNQVEEYGAYIDDISAKAPPENVE… |
| X1XDU5 | 12-158 | ISYRGDNMLVIESHHQQGRRVLLSRRNLLKLQDMQWIINEVIAQKSNIVRHMVMGQTDLMATYLYANVPVEKSSSVEEITAIICNIH… |
| X1X200 | 585-738 | None |
| A0A6G0U102 | 252-410 | None |
| J9M430 | 1-201 | None |
| J9M2F8 | 188-328 | None |
| J9L9U7 | 50-227 | None |
| A0A2S2NAZ1 | 2-144 | None |
| X1X8E3 | 1-145 | None |
| X1WU57 | 146-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.