DPCstruct | MC845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 150 ± 14 aa |
| Standard deviation of domain lengths | 13.84 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6BHX0 | 20-151 | TPEALKAANVHPLTGLATDYLNHFNEVAMLLDLLADMPEMREDVLAWRPASYREHFERSGFRGRAVAVAAYEAAPSQIRAPFDATVA… |
| A0A161K705 | 1-134 | MANINPRTGLATDYLNHFNEAVMLLEMVPDMPECAEDFLTWSPLSYAEHFTASNFKARDLAIEAYEKADPNVRAQFDHITDTMTSIL… |
| A0A4R2PTP7 | 21-193 | None |
| A0A2N8MEY7 | 1-138 | None |
| A0A2E6GM63 | 17-171 | None |
| A0A2A4UIU7 | 8-163 | None |
| A0A2A4LM22 | 7-180 | None |
| A0A1Y5DXI4 | 12-163 | None |
| A0A3T0E7J2 | 5-146 | None |
| A0A1H4TFY9 | 7-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.