DPCstruct | MC8449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 148 ± 16 aa |
| Standard deviation of domain lengths | 15.86 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E5Q8C1 | 2-128 | NVVSENNEVFNASVSVQTIEGYSGLVMESRGGAKGGVNERNTDYLLALEVILLRIFKLNIRTIKVFLVSKNALKIWPSMAQRALEVE… |
| A0A8B3H647 | 5-140 | FQISSDDGNPIDAHFGIEWDEVVFHSRGGTKGKGAINSEYALGLSVLLARLKRASFAVERVWVDSSRVQGIPISQRTILASEEGQVP… |
| A0A1Y5U030 | 3-167 | None |
| A0A7W9BVI0 | 4-146 | None |
| A0A7K0V2N1 | 105-256 | None |
| A0A7K0BLU1 | 2-156 | None |
| A0A4R6GUT2 | 2-141 | None |
| K0EMX6 | 21-182 | None |
| A0A5E9AJS0 | 4-154 | None |
| A0A0Q7N4T9 | 1-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.