DPCstruct | MC8444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 83 ± 15 aa |
| Standard deviation of domain lengths | 14.56 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 63.80 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0425- CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4E255 | 1-61 | WDVGGGYNEFDLANSTIRLVRRGFPGENRNILLSYPLNEIKSLEVEVKEGINPRRALYLIT |
| A0A1U7X7P5 | 358-435 | IAGLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRFLIKDIQSVRIEVKEGISARRVLYMDIRG |
| A0A7J7M2Y3 | 298-394 | None |
| A0A6P6FNM4 | 67-162 | None |
| A0A0E0GLC1 | 53-137 | None |
| A0A287XU34 | 67-137 | None |
| A0A5J5AJK6 | 213-278 | None |
| A0A4S8I6E4 | 166-261 | None |
| A0A8A2H7L9 | 120-208 | None |
| A0A6S7KZR9 | 541-637 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.