DPCstruct | MC8443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 7.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 66.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2PCN5 | 1-68 | MFDGTDAHYFRTGLRGHHSVWDSRLFNYGSWEVLRYLLSYARWWLEEYKFDGYRFDGVTSMMYKISLI |
| A0A446YZI1 | 128-200 | LNGYDVGQSAQESYFNTGDRGYHKLWDSRLFNYTNWEVLRFLLSNLRYWMDEFMFDGFRFDGVTSMLYNHHGI |
| A0A2P8YKC3 | 63-115 | None |
| A0A835RAU4 | 113-182 | None |
| A0A2P4Z9T7 | 284-354 | None |
| A0A199VLF6 | 531-607 | None |
| A0A803Q9L4 | 49-122 | None |
| A0A287X415 | 271-354 | None |
| A0A7J7IFJ2 | 59-129 | None |
| A0A812YYL4 | 2-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.