DPCstruct | MC8440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 240 |
|---|---|
| Mean domain length (aa) | 83 ± 12 aa |
| Standard deviation of domain lengths | 11.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.94 |
| Pfam Score | 99.47 |
| Assigned Pfam label(s) | CL0012- PF02519- PF15346 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U6VZ71 | 1-73 | MYTADGRRFEVPLAYLGTMVFSELLRMSQEEFGFTRDGRITLPCDASVLEYVMCLLRRNASEEVEKAFLSSVV |
| A0A0D2N5V5 | 14-94 | KLQRTLSGRLGNTNVPKGHIAVYVGESNKKRFVIPIAYLNHPLFQDLLNKVEEEFGFNHPMGGLTIPCSEEYFISLTTSLN |
| A0A834SV19 | 17-88 | None |
| A0A445J842 | 2-84 | None |
| A0A445J4H0 | 13-94 | None |
| A0A7N0TWE4 | 67-154 | None |
| A0A5N6Q7B2 | 22-103 | None |
| A0A1U8NVR8 | 18-101 | None |
| A0A164XFV6 | 1-72 | None |
| A0A6A6LKC9 | 26-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.