DPCstruct | MC844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 118 ± 12 aa |
| Standard deviation of domain lengths | 11.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19596 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A024KD78 | 14-130 | IKIKVPVSEYVGVAVSTRISDEGVLTSAIELVHGDPELNYQVFEEEGNYNVVAEWQNWGRKLRLPLFIKAGDGSLLPYSQQVDGVML… |
| A0A2H6BDP1 | 1-133 | MRIAVPLNCFSGVAVRVAPGEKPECDRVEVVLAHRDRALDVPLHESAPGGDGLAEWKSWGRALKLPLLVEELDGRRSTPAKLLGLVE… |
| A0A849IAD4 | 42-155 | None |
| A0A2E6Y5Z2 | 19-155 | None |
| L0EV23 | 61-174 | None |
| A0A090MUE9 | 3-117 | None |
| A0A5M8P5W5 | 95-201 | None |
| A0A8B6M6W2 | 1-89 | None |
| A0A2T1HSM2 | 47-169 | None |
| G4RB16 | 56-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.