DPCstruct | MC8438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 160 ± 18 aa |
| Standard deviation of domain lengths | 17.74 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0105- PF00623 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9P5A0 | 1-110 | MPAQERMEELGHRLSINSLKKKWSREEWASIIAAQIAVEEKIEAALLDDGFSPDAILDKRHQIRGFMFYPGGTSLTEPTYVGYVRSI… |
| A0A0D2LZH0 | 2-131 | GAPEFHPAPPDIPVLDQPLLPTSQREHELYRRFLVNSLGQDPSLERISETVRVQGLIERHIEAALVHSGFSPENIIRNRHLIRGFVF… |
| A0A251SNC7 | 15-172 | None |
| A0A2G3CZD0 | 115-290 | None |
| V9P5A6 | 13-161 | None |
| A0A6V7PYX5 | 9-159 | None |
| A0A068VCK6 | 20-201 | None |
| A0A2Z6LN57 | 49-219 | None |
| A0A7J0HE90 | 254-413 | None |
| A0A2K3NWS4 | 87-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.