DPCstruct | MC8435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 72 ± 9 aa |
| Standard deviation of domain lengths | 9.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H6SKP4 | 512-579 | MSDSTKYLLPEEQMPKAWYNLAADFPQPVPPPLHPGTMKPVTPDDLAPIFPNAVIEQEMSLERWIDIP |
| A0A6V8K7H5 | 5-76 | GTTNVLTMSEPTKILLDESEMPRRWYNVLADLPSPPPPVLHPGTLQPVGPDDLAPLFPMDLILQEVATDRYV |
| A0A0D2ZZB6 | 8-92 | None |
| A0A140LB88 | 1-64 | None |
| A0A151RHD1 | 1-79 | None |
| A0A6G3VE23 | 10-68 | None |
| A0A1Q9E6K1 | 264-348 | None |
| N1QXX5 | 185-246 | None |
| A0A7N0ZSY6 | 24-111 | None |
| X1KDA1 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.