DPCstruct | MC8434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 74 ± 9 aa |
| Standard deviation of domain lengths | 8.72 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 45.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8AKN9 | 232-300 | MPVGGFNGSDPSPTLAQFQRYVTEGRIHYFVGGGGFRANGGSNASAEISGWVAANFTAQTVDGVTLYDL |
| A0A6V8JZL7 | 1-69 | MAIGGFNGSDPSPTLAQFQRYVADGKIHYFIGSGLGRSNGGSDAAQQIATWVAENFTATTVGGTTLYDL |
| A0A1Q4D6F6 | 328-401 | None |
| A0A7K2X2T7 | 188-273 | None |
| A0A7W0NEY3 | 9-76 | None |
| A0A1Z1WE49 | 1-91 | None |
| A0A0K2RQI1 | 31-95 | None |
| A0A0K2RII3 | 1-74 | None |
| A0A7Z0W7Q1 | 99-176 | None |
| A0A2E0MQM5 | 68-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.