DPCstruct | MC8430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Standard deviation of domain lengths | 6.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0MGY9 | 1-65 | MKQLTLAEYVNIHGQEKTAKTFGIYQSAINKVIHSKRKITVFIYEDGKVEAKELKPFPSQRPNKK |
| A0A348SFI3 | 2-68 | QSIPLTKFADELGQAKAAQALGVTQGSLSKALRVGRHVFVIRHESGAYEAMELRSFPAQGRSKQGAS |
| B6XBG6 | 37-98 | None |
| A0A1N7D288 | 92-155 | None |
| A0A8A9ZXZ2 | 1-83 | None |
| A0A1E5X628 | 2-70 | None |
| A0A4Y1KPG5 | 15-73 | None |
| A0A1Q3M5B4 | 23-95 | None |
| A0A7X3HBM0 | 3-68 | None |
| A0A5N0TEM2 | 12-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.