DPCstruct | MC843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 4.72 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 26.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q5S547 | 2-68 | SEVTYYVALPFVVADDGLAPGEATECFSANAAVMRAEALSRKPGHAGALAFSRSGDPATGDFGDANL |
| A0A2H6BD79 | 6-86 | DATTTIHVVLGFRRNGKGKKEADQPFQAQSAESTKRKAQRYAEAPDGGGVAFSRTGDARMGDWEDAVILGVFGDVPEDVVE |
| Q3SMZ1 | 1-80 | None |
| A0A7W6C0S4 | 1-66 | None |
| A0A1Q3KMC2 | 343-418 | None |
| A0A2W6TUQ8 | 1-78 | None |
| A0A2A2VN15 | 1-77 | None |
| A0A5C8WGL5 | 2-72 | None |
| A0A4Q3HLD4 | 12-91 | None |
| A0A7W6WCB3 | 71-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.