DPCstruct | MC8428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1934 |
|---|---|
| Mean domain length (aa) | 87 ± 16 aa |
| Standard deviation of domain lengths | 15.73 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 17.52 |
| Pfam Score | 95.25 |
| Assigned Pfam label(s) | CL0023- CL0261- PF06985- CL0159- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F9KXS6 | 54-127 | DKGWIFTELINKEKTVIVKVDSANLRGGAGTDHETVADVKHGVVFKLLTTKGDWVKVQHADGTTGWIFSKLLWP |
| A0A0M2U142 | 84-164 | QQGTNTPLPQPTPQPQQPKVTQATVTASSANVRTGPDTSYARVVTLPQGAKVTVLEEQNGWFKIKTEDGKTGWMLGTLLKI |
| A0A399ZS69 | 287-373 | None |
| A0A847PB59 | 181-271 | None |
| A0A0S8BM76 | 102-203 | None |
| A0A847PDW1 | 399-493 | None |
| A0A1H5L1A7 | 372-454 | None |
| A0A3N9NPN8 | 91-154 | None |
| A0A7Y4ZTF5 | 8-128 | None |
| A0A316KUJ7 | 5-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.