DPCstruct | MC8427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 140 ± 10 aa |
| Standard deviation of domain lengths | 9.54 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B8RJT5 | 16-142 | YADKVINEIQELGPDCLHSGDDSGLDDVWEEFKFQVQEGESIFYEFYEATILSICSGVLKKLSVNELKLLWLISDGYYDWNEDWSPG… |
| A0A2E5T5N3 | 1-132 | MVVARTKRRLRSLFDGATLSGEGSGLLNVWDEICVQERGGRSFYWSAYEYQIEQYLYDEVARLGEPARLALWAQTPDGWDWVYDHHG… |
| A0A7W0IRB9 | 1-151 | None |
| A0A0U3EGI8 | 1-146 | None |
| A0A418MF80 | 15-152 | None |
| D2R8Y9 | 35-174 | None |
| A0A1W9KPH4 | 1-152 | None |
| A0A1Q3RSK8 | 41-195 | None |
| A0A2W7PPS9 | 23-155 | None |
| A0A7V1ZGS6 | 1-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.